PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BS_C9A338257.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 307aa    MW: 33434 Da    PI: 7.058
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BS_C9A338257.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.32.1e-10177222550
                            CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                            kr +r   NR +A+rsR RK+++i eLe+ + +L++e +aL  ++ 
  Traes_2BS_C9A338257.1 177 KRVKRILANRQSAQRSRVRKLQYISELERSITSLQTEVSALSPRVA 222
                            8999*********************************999987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.3E-13173237IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.645175231IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.97E-11177231No hitNo description
Gene3DG3DSA:1.20.5.1701.2E-13177231No hitNo description
PfamPF001702.8E-9177227IPR004827Basic-leucine zipper domain
CDDcd147031.56E-23178228No hitNo description
PROSITE patternPS000360180195IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MAQLPPKIPT MAPAWQEFGG GHHHSAHARH HHHQRSPSMG AFLAAPMPPL PPPAPASGDG  60
AQPQPFWVDE FLDFSAAKRG AHRRTVSDST AFLDDSNAAA GANEFDRLDD SQLMSIFFDE  120
LAPQRQAQAA SASSPSDHNS INDEKQDKGD AEEAQSECNG DGAAPGQPSS AATVDPKRVK  180
RILANRQSAQ RSRVRKLQYI SELERSITSL QTEVSALSPR VAFLDHQRSL LTLGNSHLKQ  240
RIAALARDKI FKDAHQEALK KEIERLRQIY QQQSLRNVEP PAHDDGRPLA RSDNNGLIAG  300
EGTAAPS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015694867.11e-132PREDICTED: basic leucine zipper 2-like
SwissprotQ5QNI51e-106BZP02_ORYSJ; Basic leucine zipper 2
TrEMBLW5BNR00.0W5BNR0_WHEAT; Uncharacterized protein
STRINGMLOC_72368.41e-158(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.12e-84bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]